Lineage for d1f2ig1 (1f2i G:1093-1131)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144569Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
  4. 144570Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) (S)
  5. 144571Family g.37.1.1: Classic zinc finger, C2H2 [57668] (14 proteins)
  6. 144647Protein ZIF268 [57669] (1 species)
  7. 144648Species Mouse (Mus musculus) [TaxId:10090] [57670] (12 PDB entries)
  8. 144682Domain d1f2ig1: 1f2i G:1093-1131 [59613]

Details for d1f2ig1

PDB Entry: 1f2i (more details), 2.35 Å

PDB Description: cocrystal structure of selected zinc finger dimer bound to dna

SCOP Domain Sequences for d1f2ig1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2ig1 g.37.1.1 (G:1093-1131) ZIF268 {Mouse (Mus musculus)}
nllnyvvpkmrpyacpvescdrrfsrsdeltrhirihtg

SCOP Domain Coordinates for d1f2ig1:

Click to download the PDB-style file with coordinates for d1f2ig1.
(The format of our PDB-style files is described here.)

Timeline for d1f2ig1: