SCOPe 2.06: Domain d1f06a2: 1f06 A:119-268

Lineage for d1f06a2 (1f06 A:119-268)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species)
   distantly related to dihydrodipicolinate reductase
   larger alpha+beta subdomain substitutes for one helix and one strand of the common fold

7. Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries)

8. Domain d1f06a2: 1f06 A:119-268 [59557]
   Other proteins in same PDB: d1f06a1, d1f06b1
   complexed with 2np, ndp

Details for d1f06a2

PDB Entry: 1f06, 2.1 Å

PDB Description: three dimensional structure of the ternary complex of corynebacterium glutamicum diaminopimelate dehydrogenase nadph-l-2-amino-6-methylene- pimelate

PDB Compounds: (A:) meso-diaminopimelate d-dehydrogenase

SCOPe Domain Sequences for d1f06a2:

Sequence; same for both SEQRES and ATOM records:

>d1f06a2 d.81.1.3 (A:119-268) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]}
wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek
arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse
htgmphgghvittgdtggfnhtveyilkld

Timeline for d1f06a2:

• d1f06a2 first appeared in SCOP 1.57
  
• d1f06a2 appears in SCOPe 2.05
  
• d1f06a2 appears in SCOPe 2.07
  
• d1f06a2 appears in the current release, SCOPe 2.08