![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) ![]() |
![]() | Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
![]() | Protein Glutamate dehydrogenase [53225] (8 species) |
![]() | Species Thermococcus profundus [TaxId:49899] [64106] (1 PDB entry) |
![]() | Domain d1euza2: 1euz A:4-180 [59514] Other proteins in same PDB: d1euza1, d1euzb1, d1euzc1, d1euzd1, d1euze1, d1euzf1 complexed with so4 |
PDB Entry: 1euz (more details), 2.25 Å
SCOPe Domain Sequences for d1euza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euza2 c.58.1.1 (A:4-180) Glutamate dehydrogenase {Thermococcus profundus [TaxId: 49899]} idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkpls
Timeline for d1euza2: