Lineage for d1euea_ (1eue A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536940Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2536941Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2536942Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2536943Protein Cytochrome b5 [55858] (4 species)
  7. 2536965Species Norway rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries)
  8. 2536976Domain d1euea_: 1eue A: [59504]
    complexed with hem

Details for d1euea_

PDB Entry: 1eue (more details), 1.8 Å

PDB Description: rat outer mitochondrial membrane cytochrome b5
PDB Compounds: (A:) cytochrome b5

SCOPe Domain Sequences for d1euea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euea_ d.120.1.1 (A:) Cytochrome b5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeeilleqagadatesfed
ighspdaremlkqyyigdvhpndlkp

SCOPe Domain Coordinates for d1euea_:

Click to download the PDB-style file with coordinates for d1euea_.
(The format of our PDB-style files is described here.)

Timeline for d1euea_: