PDB entry 1eue

View 1eue on RCSB PDB site
Description: rat outer mitochondrial membrane cytochrome b5
Class: electron transport
Keywords: cytochrome, heme, electron transport
Deposited on 2000-04-19, released 2001-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04166 (0-85)
      • engineered (44)
      • engineered (60)
    Domains in SCOPe 2.07: d1euea_
  • Chain 'B':
    Compound: cytochrome b5
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04166 (0-85)
      • engineered (44)
      • engineered (60)
    Domains in SCOPe 2.07: d1eueb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eueA (A:)
    dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeeilleqagadatesfed
    ighspdaremlkqyyigdvhpndlkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eueB (B:)
    dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeeilleqagadatesfed
    ighspdaremlkqyyigdvhpndlkp