Lineage for d1ejbe_ (1ejb E:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2437440Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2437441Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2437442Family c.16.1.1: Lumazine synthase [52122] (2 protein domains)
  6. 2437443Protein Lumazine synthase [52123] (7 species)
  7. 2437511Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63960] (1 PDB entry)
  8. 2437516Domain d1ejbe_: 1ejb E: [59421]
    complexed with inj

Details for d1ejbe_

PDB Entry: 1ejb (more details), 1.85 Å

PDB Description: lumazine synthase from saccharomyces cerevisiae
PDB Compounds: (E:) lumazine synthase

SCOPe Domain Sequences for d1ejbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejbe_ c.16.1.1 (E:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs
yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv
ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf

SCOPe Domain Coordinates for d1ejbe_:

Click to download the PDB-style file with coordinates for d1ejbe_.
(The format of our PDB-style files is described here.)

Timeline for d1ejbe_: