PDB entry 1ejb

View 1ejb on RCSB PDB site
Description: lumazine synthase from saccharomyces cerevisiae
Class: transferase
Keywords: Lumazine synthase, Saccharomyces cerevisiae, X-ray structure analysis, Inhibitor complex, Vitamin biosynthesis, TRANSFERASE
Deposited on 2000-03-02, released 2001-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lumazine synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50861 (0-167)
      • see remark 999 (42)
      • see remark 999 (49)
    Domains in SCOPe 2.07: d1ejba_
  • Chain 'B':
    Compound: lumazine synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50861 (0-167)
      • see remark 999 (42)
      • see remark 999 (49)
    Domains in SCOPe 2.07: d1ejbb_
  • Chain 'C':
    Compound: lumazine synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50861 (0-167)
      • see remark 999 (42)
      • see remark 999 (49)
    Domains in SCOPe 2.07: d1ejbc_
  • Chain 'D':
    Compound: lumazine synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50861 (0-167)
      • see remark 999 (42)
      • see remark 999 (49)
    Domains in SCOPe 2.07: d1ejbd_
  • Chain 'E':
    Compound: lumazine synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50861 (0-167)
      • see remark 999 (42)
      • see remark 999 (49)
    Domains in SCOPe 2.07: d1ejbe_
  • Heterogens: INJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejbA (A:)
    avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs
    yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv
    ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejbB (B:)
    avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs
    yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv
    ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejbC (C:)
    avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs
    yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv
    ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejbD (D:)
    avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs
    yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv
    ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejbE (E:)
    avkglgkpdqvydgskirvgiiharwnrviidalvkgaiermaslgveenniiietvpgs
    yelpwgtkrfvdrqaklgkpldvvipigvlikgstmhfeyisdstthalmnlqekvdmpv
    ifglltcmteeqalaragideahsmhnhgedwgaaavemavkfgknaf