Lineage for d1ecsb_ (1ecs B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190970Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 190971Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 191000Family d.32.1.2: Antibiotic resistance proteins [54598] (2 proteins)
  6. 191001Protein Bleomycin resistance protein, BRP [54599] (3 species)
  7. 191002Species Klebsiella pneumoniae [TaxId:573] [64256] (2 PDB entries)
  8. 191004Domain d1ecsb_: 1ecs B: [59408]

Details for d1ecsb_

PDB Entry: 1ecs (more details), 1.7 Å

PDB Description: the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5

SCOP Domain Sequences for d1ecsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecsb_ d.32.1.2 (B:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqgwggtmaalvdpdgtllrliqnel

SCOP Domain Coordinates for d1ecsb_:

Click to download the PDB-style file with coordinates for d1ecsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ecsb_: