Lineage for d1ea8a_ (1ea8 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279291Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 279292Superfamily a.24.1: Apolipoprotein [47162] (1 family) (S)
  5. 279293Family a.24.1.1: Apolipoprotein [47163] (1 protein)
    Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
    family may also include the five-helical bundle protein Apolipophorin-III
  6. 279294Protein Apolipoprotein E [88703] (3 species)
  7. 279298Species Human (Homo sapiens), E3 [TaxId:9606] [47165] (7 PDB entries)
  8. 279301Domain d1ea8a_: 1ea8 A: [59400]
    mutant

Details for d1ea8a_

PDB Entry: 1ea8 (more details), 1.95 Å

PDB Description: apolipoprotein e3 22kd fragment lys146glu mutant

SCOP Domain Sequences for d1ea8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea8a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E3}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
klrerllrdaddlqkrlavy

SCOP Domain Coordinates for d1ea8a_:

Click to download the PDB-style file with coordinates for d1ea8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ea8a_: