Lineage for d1ea8a_ (1ea8 A:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies) 
Superfamily a.24.1: Apolipoprotein [47162] (1 family) 
Family a.24.1.1: Apolipoprotein [47163] (3 proteins) Protein Apolipoprotein E3 [47164] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47165] (7 PDB entries) 
Domain d1ea8a_: 1ea8 A: [59400]
Details for d1ea8a_
PDB Entry: 1ea8 (more details), 1.95 Å
PDB Description: apolipoprotein e3 22kd fragment lys146glu mutant
SCOP Domain Sequences for d1ea8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ea8a_ a.24.1.1 (A:) Apolipoprotein E3 {Human (Homo sapiens)}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
klrerllrdaddlqkrlavy
SCOP Domain Coordinates for d1ea8a_:
Click to download the PDB-style file with coordinates for d1ea8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ea8a_:
- d1ea8a_ is new in SCOP 1.57
- d1ea8a_ appears in SCOP 1.59
- d1ea8a_ appears in the current release, SCOPe 2.08
View in 3D