SCOPe 2.05: Domain d1e9la2: 1e9l A:267-336

Lineage for d1e9la2 (1e9l A:267-336)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase-like lectin ym1 [64252] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64253] (2 PDB entries)

8. Domain d1e9la2: 1e9l A:267-336 [59396]
   Other proteins in same PDB: d1e9la1
   complexed with gcs

Details for d1e9la2

PDB Entry: 1e9l, 2.5 Å

PDB Description: the crystal structure of novel mammalian lectin ym1 suggests a saccharide binding site

PDB Compounds: (A:) ym1 secretory protein

SCOPe Domain Sequences for d1e9la2:

Sequence; same for both SEQRES and ATOM records:

>d1e9la2 d.26.3.1 (A:267-336) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]}
yghtfilsdpsktgigaptistgppgkytdesgllayyevctflnegatevwdapqevpy
ayqgnewvgy

Timeline for d1e9la2:

• d1e9la2 first appeared in SCOP 1.57
  
• d1e9la2 appears in SCOPe 2.04
  
• d1e9la2 appears in SCOPe 2.06
  
• d1e9la2 appears in the current release, SCOPe 2.08