Lineage for d1e9la2 (1e9l A:267-336)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644292Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1644695Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1644696Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1644821Protein Chitinase-like lectin ym1 [64252] (1 species)
  7. 1644822Species Mouse (Mus musculus) [TaxId:10090] [64253] (2 PDB entries)
  8. 1644824Domain d1e9la2: 1e9l A:267-336 [59396]
    Other proteins in same PDB: d1e9la1
    complexed with gcs

Details for d1e9la2

PDB Entry: 1e9l (more details), 2.5 Å

PDB Description: the crystal structure of novel mammalian lectin ym1 suggests a saccharide binding site
PDB Compounds: (A:) ym1 secretory protein

SCOPe Domain Sequences for d1e9la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9la2 d.26.3.1 (A:267-336) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]}
yghtfilsdpsktgigaptistgppgkytdesgllayyevctflnegatevwdapqevpy
ayqgnewvgy

SCOPe Domain Coordinates for d1e9la2:

Click to download the PDB-style file with coordinates for d1e9la2.
(The format of our PDB-style files is described here.)

Timeline for d1e9la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e9la1