Lineage for d1e8da_ (1e8d A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (22 families) 
Family c.69.1.20: Hydroxynitrile lyase [53585] (1 protein) Protein Hydroxynitrile lyase [53586] (2 species) 
Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (7 PDB entries) 
Domain d1e8da_: 1e8d A: [59383]
Details for d1e8da_
PDB Entry: 1e8d (more details), 2.2 Å
PDB Description: mechanistic aspects of cyanogenesis from active site mutant ser80ala of hydroxynitrile lyase from manihot esculenta in complex with acetone cyanohydrin
SCOP Domain Sequences for d1e8da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8da_ c.69.1.20 (A:) Hydroxynitrile lyase {Cassava (Manihot esculenta)}
piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
yseplltfleklpqgekviivgeacaglniaiaadryvdkiaagvfhnsllpdtvhspsy
tvekllesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
klqltkteevahilqevadaya
SCOP Domain Coordinates for d1e8da_:
Click to download the PDB-style file with coordinates for d1e8da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e8da_:
- d1e8da_ first appeared in SCOP 1.57
- d1e8da_ appears in SCOP 1.61
- d1e8da_ appears in the current release, SCOPe 2.08, called d1e8da1
View in 3D
