| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) ![]() |
| Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins) |
| Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [64107] (1 species) |
| Species Escherichia coli [TaxId:562] [64108] (1 PDB entry) |
| Domain d1e8cb2: 1e8c B:338-498 [59381] Other proteins in same PDB: d1e8ca1, d1e8ca3, d1e8cb1, d1e8cb3 complexed with api, cl, uag |
PDB Entry: 1e8c (more details), 2 Å
SCOPe Domain Sequences for d1e8cb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8cb2 c.59.1.1 (B:338-498) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]}
vcgrmevftapgkptvvvdyahtpdalekalqaarlhcagklwcvfgcggdrdkgkrplm
gaiaeefadvavvtddnprteepraiindilagmldaghakvmegraeavtcavmqaken
dvvlvagkghedyqivgnqrldysdrvtvarllgviarshh
Timeline for d1e8cb2: