Lineage for d1e8ca1 (1e8c A:3-103)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393484Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core.
  4. 1393485Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (1 family) (S)
    binds UDP group
  5. 1393486Family c.98.1.1: MurE/MurF N-terminal domain [63419] (2 proteins)
  6. 1393491Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [63951] (1 species)
  7. 1393492Species Escherichia coli [TaxId:562] [63952] (1 PDB entry)
  8. 1393493Domain d1e8ca1: 1e8c A:3-103 [59377]
    Other proteins in same PDB: d1e8ca2, d1e8ca3, d1e8cb2, d1e8cb3
    complexed with api, cl, uag

Details for d1e8ca1

PDB Entry: 1e8c (more details), 2 Å

PDB Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli
PDB Compounds: (A:) udp-n-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase

SCOPe Domain Sequences for d1e8ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ca1 c.98.1.1 (A:3-103) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]}
rnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaai
iaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhe

SCOPe Domain Coordinates for d1e8ca1:

Click to download the PDB-style file with coordinates for d1e8ca1.
(The format of our PDB-style files is described here.)

Timeline for d1e8ca1: