Lineage for d1e7pa2 (1e7p A:1-250,A:372-457)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1154265Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1154266Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1154657Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 1154696Protein Fumarate reductase [51937] (2 species)
  7. 1154708Species Wolinella succinogenes [TaxId:844] [51939] (5 PDB entries)
  8. 1154717Domain d1e7pa2: 1e7p A:1-250,A:372-457 [59348]
    Other proteins in same PDB: d1e7pa1, d1e7pa3, d1e7pb1, d1e7pb2, d1e7pc_, d1e7pd1, d1e7pd3, d1e7pe1, d1e7pe2, d1e7pf_, d1e7pg1, d1e7pg3, d1e7ph1, d1e7ph2, d1e7pi_, d1e7pj1, d1e7pj3, d1e7pk1, d1e7pk2, d1e7pl_
    complexed with f3s, fad, fes, hem, lmt, mla, na, sf4

Details for d1e7pa2

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1e7pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7pa2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
letgiaqlgnXmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
geyfaehcantqvdletktlekfvkgqeaymkslves

SCOPe Domain Coordinates for d1e7pa2:

Click to download the PDB-style file with coordinates for d1e7pa2.
(The format of our PDB-style files is described here.)

Timeline for d1e7pa2: