![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) ![]() this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
![]() | Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins) |
![]() | Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries) |
![]() | Domain d1e6ea2: 1e6e A:4-106,A:332-460 [59299] Other proteins in same PDB: d1e6ea1, d1e6eb_, d1e6ec1, d1e6ed_ complexed with fad, fes, so4 |
PDB Entry: 1e6e (more details), 2.3 Å
SCOPe Domain Sequences for d1e6ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6ea2 c.4.1.1 (A:4-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} eqtpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvin tftqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklg vvpnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgs afikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh
Timeline for d1e6ea2:
![]() Domains from other chains: (mouse over for more information) d1e6eb_, d1e6ec1, d1e6ec2, d1e6ed_ |