SCOPe 2.08: Domain d1e6ec2: 1e6e C:5-106,C:332-460

Lineage for d1e6ec2 (1e6e C:5-106,C:332-460)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)

6. Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries)

8. Domain d1e6ec2: 1e6e C:5-106,C:332-460 [59302]
   Other proteins in same PDB: d1e6ea1, d1e6eb_, d1e6ec1, d1e6ed_
   complexed with fad, fes, so4

Details for d1e6ec2

PDB Entry: 1e6e, 2.3 Å

PDB Description: adrenodoxin reductase/adrenodoxin complex of mitochondrial p450 systems

PDB Compounds: (C:) nadph:adrenodoxin oxidoreductase

SCOPe Domain Sequences for d1e6ec2:

Sequence; same for both SEQRES and ATOM records:

>d1e6ec2 c.4.1.1 (C:5-106,C:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}
qtpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvint
ftqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklgv
vpnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsa
fikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh

Timeline for d1e6ec2:

• d1e6ec2 first appeared in SCOP 1.57
  
• d1e6ec2 appears in SCOPe 2.07