Lineage for d1e57a_ (1e57 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472284Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 472367Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) (S)
  5. 472701Family b.121.4.6: Tymoviridae-like VP [88641] (1 protein)
  6. 472702Protein Tymovirus coat protein [88642] (3 species)
  7. 472707Species PHMV (Physalis mottle virus) [TaxId:72539] [49642] (2 PDB entries)
  8. 472708Domain d1e57a_: 1e57 A: [59259]

Details for d1e57a_

PDB Entry: 1e57 (more details), 3.2 Å

PDB Description: physalis mottle virus: empty capsid

SCOP Domain Sequences for d1e57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e57a_ b.121.4.6 (A:) Tymovirus coat protein {PHMV (Physalis mottle virus)}
spaivlpfqfeattfgtaetaaqvslqtadpitkltapyrhaqiveckailtptdlavsn
pltvylawvpanspatptqilrvyggqsfvlggaisaaktievplnldsvnrmlkdsvty
tdtpkllaysraptnpskiptasiqisgrirlskpmlian

SCOP Domain Coordinates for d1e57a_:

Click to download the PDB-style file with coordinates for d1e57a_.
(The format of our PDB-style files is described here.)

Timeline for d1e57a_: