Class b: All beta proteins [48724] (149 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) |
Family b.121.4.6: Tymoviridae-like VP [88641] (1 protein) |
Protein Tymovirus coat protein [88642] (3 species) |
Species PHMV (Physalis mottle virus) [TaxId:72539] [49642] (2 PDB entries) |
Domain d1e57a_: 1e57 A: [59259] |
PDB Entry: 1e57 (more details), 3.2 Å
SCOP Domain Sequences for d1e57a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e57a_ b.121.4.6 (A:) Tymovirus coat protein {PHMV (Physalis mottle virus)} spaivlpfqfeattfgtaetaaqvslqtadpitkltapyrhaqiveckailtptdlavsn pltvylawvpanspatptqilrvyggqsfvlggaisaaktievplnldsvnrmlkdsvty tdtpkllaysraptnpskiptasiqisgrirlskpmlian
Timeline for d1e57a_: