Lineage for d1e50r_ (1e50 R:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 456653Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 456866Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 456974Family b.2.5.6: RUNT domain [81318] (1 protein)
  6. 456975Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 456976Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries)
  8. 456986Domain d1e50r_: 1e50 R: [59253]
    Other proteins in same PDB: d1e50b_, d1e50d_, d1e50f_, d1e50h_

Details for d1e50r_

PDB Entry: 1e50 (more details), 2.6 Å

PDB Description: aml1/cbfbeta complex

SCOP Domain Sequences for d1e50r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e50r_ b.2.5.6 (R:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens)}
lvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrnat
aamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvd

SCOP Domain Coordinates for d1e50r_:

Click to download the PDB-style file with coordinates for d1e50r_.
(The format of our PDB-style files is described here.)

Timeline for d1e50r_: