SCOP 1.69: Domain d1e32a2: 1e32 A:201-458

Lineage for d1e32a2 (1e32 A:201-458)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (25 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Membrane fusion ATPase VCP/p97 [64038] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64039] (4 PDB entries)

8. Domain d1e32a2: 1e32 A:201-458 [59184]
   Other proteins in same PDB: d1e32a1, d1e32a3
   D1 domain from the N-D1 fragment

Details for d1e32a2

PDB Entry: 1e32, 2.9 Å

PDB Description: structure of the n-terminal domain and the d1 aaa domain of membrane fusion atpase p97

SCOP Domain Sequences for d1e32a2:

Sequence; same for both SEQRES and ATOM records:

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus)}
vgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsq

Timeline for d1e32a2:

• d1e32a2 first appeared in SCOP 1.57
  
• d1e32a2 appears in SCOP 1.67
  
• d1e32a2 appears in SCOP 1.71
  
• d1e32a2 appears in the current release, SCOPe 2.08