![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (18 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein Membrane fusion ATPase VCP/p97 [64038] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [64039] (4 PDB entries) |
![]() | Domain d1e32a2: 1e32 A:201-458 [59184] Other proteins in same PDB: d1e32a1, d1e32a3 complexed with adp D1 domain from the N-D1 fragment |
PDB Entry: 1e32 (more details), 2.9 Å
SCOP Domain Sequences for d1e32a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus)} vgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae vmnslavtmddfrwalsq
Timeline for d1e32a2: