Lineage for d1dzia_ (1dzi A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247390Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 247391Superfamily c.62.1: vWA-like [53300] (2 families) (S)
  5. 247392Family c.62.1.1: Integrin A (or I) domain [53301] (8 proteins)
  6. 247403Protein Integrin alpha2-beta1 [53313] (1 species)
  7. 247404Species Human (Homo sapiens) [TaxId:9606] [53314] (2 PDB entries)
  8. 247407Domain d1dzia_: 1dzi A: [59142]
    Other proteins in same PDB: d1dzib_, d1dzic_, d1dzid_
    complexed with co, nh2

Details for d1dzia_

PDB Entry: 1dzi (more details), 2.1 Å

PDB Description: integrin alpha2 i domain / collagen complex

SCOP Domain Sequences for d1dzia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzia_ c.62.1.1 (A:) Integrin alpha2-beta1 {Human (Homo sapiens)}
alidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyk
tkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgs
mlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaal
lekag

SCOP Domain Coordinates for d1dzia_:

Click to download the PDB-style file with coordinates for d1dzia_.
(The format of our PDB-style files is described here.)

Timeline for d1dzia_: