SCOP 1.59: Domain d1dm3c2: 1dm3 C:269-392

Lineage for d1dm3c2 (1dm3 C:269-392)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)

6. Protein Biosynthetic thiolase [53905] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [53906] (4 PDB entries)

8. Domain d1dm3c2: 1dm3 C:269-392 [59123]

Details for d1dm3c2

PDB Entry: 1dm3, 2 Å

PDB Description: acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa

SCOP Domain Sequences for d1dm3c2:

Sequence; same for both SEQRES and ATOM records:

>d1dm3c2 c.95.1.1 (C:269-392) Biosynthetic thiolase {Zoogloea ramigera}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

Timeline for d1dm3c2:

• d1dm3c2 first appeared in SCOP 1.57
  
• d1dm3c2 appears in SCOP 1.61
  
• d1dm3c2 appears in the current release, SCOPe 2.08