Lineage for d1d9ua_ (1d9u A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533548Family d.2.1.4: Lambda lysozyme [53984] (1 protein)
  6. 2533549Protein Lambda lysozyme [53985] (1 species)
  7. 2533550Species Bacteriophage lambda [TaxId:10710] [53986] (3 PDB entries)
  8. 2533554Domain d1d9ua_: 1d9u A: [59111]
    complexed with a chitohexasacharide
    complexed with so4

Details for d1d9ua_

PDB Entry: 1d9u (more details), 2.6 Å

PDB Description: bacteriophage lambda lysozyme complexed with a chitohexasacharide
PDB Compounds: (A:) bacteriophage lambda lysozyme

SCOPe Domain Sequences for d1d9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9ua_ d.2.1.4 (A:) Lambda lysozyme {Bacteriophage lambda [TaxId: 10710]}
mveinnqrkafldmlawsegtdngrqktrnhgydvivggelftdysdhprklvtlnpklk
stgagryqllsrwwdayrkqlglkdfspksqdavalqqikergalpmidrgdirqaidrc
sniwaslpgagygqfehkadsliakfkeaggtvr

SCOPe Domain Coordinates for d1d9ua_:

Click to download the PDB-style file with coordinates for d1d9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1d9ua_: