Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein Cytochrome P450-CAM [48266] (1 species) |
Species Pseudomonas putida [TaxId:303] [48267] (121 PDB entries) Uniprot P00183 |
Domain d1c8ja_: 1c8j A: [59085] complexed with hem; mutant |
PDB Entry: 1c8j (more details), 2.1 Å
SCOPe Domain Sequences for d1c8ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8ja_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d1c8ja_: