Lineage for d1qr0a1 (1qr0 A:1-101)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419815Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 419816Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 419817Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (1 protein)
    monomeric; tandem duplication of beta-alpha(3)-beta(2) motif
  6. 419818Protein 4'-Phosphopantetheinyl transferase SFP [63407] (1 species)
  7. 419819Species Bacillus subtilis [TaxId:1423] [56217] (1 PDB entry)
  8. 419820Domain d1qr0a1: 1qr0 A:1-101 [59038]

Details for d1qr0a1

PDB Entry: 1qr0 (more details), 1.9 Å

PDB Description: crystal structure of the 4'-phosphopantetheinyl transferase sfp- coenzyme a complex

SCOP Domain Sequences for d1qr0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr0a1 d.150.1.1 (A:1-101) 4'-Phosphopantetheinyl transferase SFP {Bacillus subtilis}
mkiygiymdrplsqeenerfmtfispekrekcrrfyhkedahrtllgdvlvrsvisrqyq
ldksdirfstqeygkpcipdlpdahfnishsgrwvigafds

SCOP Domain Coordinates for d1qr0a1:

Click to download the PDB-style file with coordinates for d1qr0a1.
(The format of our PDB-style files is described here.)

Timeline for d1qr0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qr0a2