| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families) ![]() possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
| Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (1 protein) monomeric; tandem duplication of beta-alpha(3)-beta(2) motif |
| Protein 4'-Phosphopantetheinyl transferase SFP [63407] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [56217] (1 PDB entry) |
| Domain d1qr0a1: 1qr0 A:1-101 [59038] |
PDB Entry: 1qr0 (more details), 1.9 Å
SCOP Domain Sequences for d1qr0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qr0a1 d.150.1.1 (A:1-101) 4'-Phosphopantetheinyl transferase SFP {Bacillus subtilis}
mkiygiymdrplsqeenerfmtfispekrekcrrfyhkedahrtllgdvlvrsvisrqyq
ldksdirfstqeygkpcipdlpdahfnishsgrwvigafds
Timeline for d1qr0a1: