| Class b: All beta proteins [48724] (178 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.1: PHM/PNGase F [49742] (2 families) ![]() members of this superfamily bind peptide substrates duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits |
| Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein) |
| Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (26 PDB entries) |
| Domain d1phma2: 1phm A:199-354 [59016] complexed with azi, cu, gol |
PDB Entry: 1phm (more details), 1.9 Å
SCOPe Domain Sequences for d1phma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1phma2 b.121.1.2 (A:199-354) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng
qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegrteathiggtssdemcnly
imyymeakyalsfmtctknvapdmfrtipaeanipi
Timeline for d1phma2: