Lineage for d1g2913 (1g29 1:241-301)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1542493Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 1542577Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 1542597Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 1542637Species Thermococcus litoralis [TaxId:2265] [50340] (1 PDB entry)
  8. 1542638Domain d1g2913: 1g29 1:241-301 [58981]
    Other proteins in same PDB: d1g2912, d1g2922
    CASP4
    complexed with cl, dio, mg, na, nh4, pop

Details for d1g2913

PDB Entry: 1g29 (more details), 1.9 Å

PDB Description: malk
PDB Compounds: (1:) maltose transport protein malk

SCOPe Domain Sequences for d1g2913:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2913 b.40.6.3 (1:241-301) Maltose transport protein MalK, C-terminal domain {Thermococcus litoralis [TaxId: 2265]}
gsppmnfldaivtedgfvdfgefrlkllpdqfevlgelgyvgrevifgirpedlydamfa
q

SCOPe Domain Coordinates for d1g2913:

Click to download the PDB-style file with coordinates for d1g2913.
(The format of our PDB-style files is described here.)

Timeline for d1g2913: