Lineage for d1e5ma2 (1e5m A:256-416)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2523779Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2523963Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)
  7. 2523999Species Synechocystis sp. [TaxId:1143] [53911] (1 PDB entry)
  8. 2524001Domain d1e5ma2: 1e5m A:256-416 [58974]

Details for d1e5ma2

PDB Entry: 1e5m (more details), 1.54 Å

PDB Description: beta ketoacyl acyl carrier protein synthase ii (kasii) from synechocystis sp.
PDB Compounds: (A:) beta ketoacyl acyl carrier protein synthase II

SCOPe Domain Sequences for d1e5ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]}
kiygemvgyamtcdayhitapvpdgrgatraiawalkdsglkpemvsyinahgtstpand
vtetraikqalgnhayniavsstksmtghllggsggieavatvmaiaedkvpptinlenp
dpecdldyvpgqsralivdvalsnsfgfgghnvtlafkkyq

SCOPe Domain Coordinates for d1e5ma2:

Click to download the PDB-style file with coordinates for d1e5ma2.
(The format of our PDB-style files is described here.)

Timeline for d1e5ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5ma1