Lineage for d1ck7a7 (1ck7 A:108-216,A:394-449)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82192Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 82193Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) (S)
  5. 82321Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (8 proteins)
  6. 82350Protein Gelatinase A [55534] (1 species)
  7. 82351Species Human (Homo sapiens) [TaxId:9606] [55535] (2 PDB entries)
  8. 82353Domain d1ck7a7: 1ck7 A:108-216,A:394-449 [58970]
    Other proteins in same PDB: d1ck7a1, d1ck7a3, d1ck7a4, d1ck7a5, d1ck7a6

Details for d1ck7a7

PDB Entry: 1ck7 (more details), 2.8 Å

PDB Description: gelatinase a (full-length)

SCOP Domain Sequences for d1ck7a7:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck7a7 d.92.1.11 (A:108-216,A:394-449) Gelatinase A {Human (Homo sapiens)}
anynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgea
diminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgXgyslflvaah
afghamglehsqdpgalmapiytytknfrlsqddikgiqelygasp

SCOP Domain Coordinates for d1ck7a7:

Click to download the PDB-style file with coordinates for d1ck7a7.
(The format of our PDB-style files is described here.)

Timeline for d1ck7a7: