Lineage for d1ck7a4 (1ck7 A:278-335)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89571Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 89572Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 89631Family g.14.1.2: Fibronectin type II module [57459] (3 proteins)
  6. 89640Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
  7. 89641Species Human (Homo sapiens) [TaxId:9606] [57465] (3 PDB entries)
  8. 89643Domain d1ck7a4: 1ck7 A:278-335 [44675]
    Other proteins in same PDB: d1ck7a1, d1ck7a6, d1ck7a7

Details for d1ck7a4

PDB Entry: 1ck7 (more details), 2.8 Å

PDB Description: gelatinase a (full-length)

SCOP Domain Sequences for d1ck7a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck7a4 g.14.1.2 (A:278-335) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens)}
alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpet

SCOP Domain Coordinates for d1ck7a4:

Click to download the PDB-style file with coordinates for d1ck7a4.
(The format of our PDB-style files is described here.)

Timeline for d1ck7a4: