Lineage for d1cjdc1 (1cjd C:16-244)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821570Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 2821571Family b.121.2.1: Coat protein p3 [49750] (3 proteins)
  6. 2821583Protein Coat protein p3, N-terminal domain [418928] (1 species)
  7. 2821584Species Bacteriophage PRD1 [TaxId:10658] [419360] (3 PDB entries)
  8. 2821593Domain d1cjdc1: 1cjd C:16-244 [58967]
    Other proteins in same PDB: d1cjda2, d1cjdb2, d1cjdc2
    has additional insertions and/or extensions that are not grouped together

Details for d1cjdc1

PDB Entry: 1cjd (more details), 1.85 Å

PDB Description: the bacteriophage prd1 coat protein, p3, is structurally similar to human adenovirus hexon
PDB Compounds: (C:) protein (major capsid protein (p3))

SCOPe Domain Sequences for d1cjdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjdc1 b.121.2.1 (C:16-244) Coat protein p3, N-terminal domain {Bacteriophage PRD1 [TaxId: 10658]}
rnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvtaa
itnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmvt
dspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkle
fannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgq

SCOPe Domain Coordinates for d1cjdc1:

Click to download the PDB-style file with coordinates for d1cjdc1.
(The format of our PDB-style files is described here.)

Timeline for d1cjdc1: