Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
Family b.121.2.1: Coat protein p3 [49750] (3 proteins) |
Protein Coat protein p3, N-terminal domain [418928] (1 species) |
Species Bacteriophage PRD1 [TaxId:10658] [419360] (3 PDB entries) |
Domain d1cjdc1: 1cjd C:16-244 [58967] Other proteins in same PDB: d1cjda2, d1cjdb2, d1cjdc2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1cjd (more details), 1.85 Å
SCOPe Domain Sequences for d1cjdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjdc1 b.121.2.1 (C:16-244) Coat protein p3, N-terminal domain {Bacteriophage PRD1 [TaxId: 10658]} rnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvtaa itnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmvt dspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkle fannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgq
Timeline for d1cjdc1:
View in 3D Domains from other chains: (mouse over for more information) d1cjda1, d1cjda2, d1cjdb1, d1cjdb2 |