Lineage for d1qp6b_ (1qp6 B:)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048123Fold k.16: alpha2d [58882] (1 superfamily)
  4. 3048124Superfamily k.16.1: alpha2d [58883] (1 family) (S)
  5. 3048125Family k.16.1.1: alpha2d [58884] (1 protein)
  6. 3048126Protein alpha2d [58885] (1 species)
  7. 3048127Species Synthetic [58886] (1 PDB entry)
  8. 3048129Domain d1qp6b_: 1qp6 B: [46444]

Details for d1qp6b_

PDB Entry: 1qp6 (more details)

PDB Description: solution structure of alpha2d
PDB Compounds: (B:) protein (alpha2d)

SCOPe Domain Sequences for d1qp6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp6b_ k.16.1.1 (B:) alpha2d {Synthetic}
geveelekkfkelwkgprrgeieelhkkfhelikg

SCOPe Domain Coordinates for d1qp6b_:

Click to download the PDB-style file with coordinates for d1qp6b_.
(The format of our PDB-style files is described here.)

Timeline for d1qp6b_:

3048129
d1qp6b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1qp6a_