Lineage for d1meyc_ (1mey C:)

  1. Root: SCOPe 2.02
  2. 1253041Class k: Designed proteins [58788] (44 folds)
  3. 1253266Fold k.12: Zinc finger design [58856] (1 superfamily)
  4. 1253267Superfamily k.12.1: Zinc finger design [58857] (1 family) (S)
  5. 1253268Family k.12.1.1: Zinc finger design [58858] (7 proteins)
  6. 1253273Protein Designed zinc finger protein [58859] (1 species)
  7. 1253274Species Synthetic consensus sequence, non-biological source [58860] (1 PDB entry)
  8. 1253275Domain d1meyc_: 1mey C: [46430]
    protein/DNA complex; complexed with cl, zn

Details for d1meyc_

PDB Entry: 1mey (more details), 2.2 Å

PDB Description: crystal structure of a designed zinc finger protein bound to dna
PDB Compounds: (C:) consensus zinc finger

SCOPe Domain Sequences for d1meyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1meyc_ k.12.1.1 (C:) Designed zinc finger protein {Synthetic consensus sequence, non-biological source}
ekpykcpecgksfsqssnlqkhqrthtgekpykcpecgksfsqssdlqkhqrthtgekpy
kcpecgksfsrsdhlsrhqrthq

SCOPe Domain Coordinates for d1meyc_:

Click to download the PDB-style file with coordinates for d1meyc_.
(The format of our PDB-style files is described here.)

Timeline for d1meyc_: