![]() | Class k: Designed proteins [58788] (44 folds) |
![]() | Fold k.12: Zinc finger design [58856] (1 superfamily) |
![]() | Superfamily k.12.1: Zinc finger design [58857] (1 family) ![]() |
![]() | Family k.12.1.1: Zinc finger design [58858] (7 proteins) |
![]() | Protein Designed zinc finger protein [58859] (1 species) |
![]() | Species Synthetic consensus sequence, non-biological source [58860] (1 PDB entry) |
![]() | Domain d1meyc_: 1mey C: [46430] protein/DNA complex; complexed with cl, zn |
PDB Entry: 1mey (more details), 2.2 Å
SCOPe Domain Sequences for d1meyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1meyc_ k.12.1.1 (C:) Designed zinc finger protein {Synthetic consensus sequence, non-biological source} ekpykcpecgksfsqssnlqkhqrthtgekpykcpecgksfsqssdlqkhqrthtgekpy kcpecgksfsrsdhlsrhqrthq
Timeline for d1meyc_: