Lineage for d1g3jd_ (1g3j D:)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2272745Fold j.71: beta-Catenine bound non-globular protein regions [58753] (1 superfamily)
  4. 2272746Superfamily j.71.1: beta-Catenine bound non-globular protein regions [58754] (1 family) (S)
  5. 2272747Family j.71.1.1: beta-Catenine bound non-globular protein regions [58755] (3 proteins)
  6. 2272760Protein TCF3-CBD (catenin-binding domain) [58756] (1 species)
  7. 2272761Species Frog (Xenopus) [TaxId:262014] [58757] (1 PDB entry)
  8. 2272763Domain d1g3jd_: 1g3j D: [46367]
    Other proteins in same PDB: d1g3ja_, d1g3jc_

Details for d1g3jd_

PDB Entry: 1g3j (more details), 2.1 Å

PDB Description: crystal structure of the xtcf3-cbd/beta-catenin armadillo repeat complex
PDB Compounds: (D:) tcf3-cbd (catenin binding domain)

SCOPe Domain Sequences for d1g3jd_:

Sequence, based on SEQRES records: (download)

>d1g3jd_ j.71.1.1 (D:) TCF3-CBD (catenin-binding domain) {Frog (Xenopus) [TaxId: 262014]}
pqlnsgggdelgandelirfkdegeqeekspgegsaegdladvksslvn

Sequence, based on observed residues (ATOM records): (download)

>d1g3jd_ j.71.1.1 (D:) TCF3-CBD (catenin-binding domain) {Frog (Xenopus) [TaxId: 262014]}
pqlnsgggdelgandelirfkdedladvksslvn

SCOPe Domain Coordinates for d1g3jd_:

Click to download the PDB-style file with coordinates for d1g3jd_.
(The format of our PDB-style files is described here.)

Timeline for d1g3jd_: