SCOP 1.65: Domain d1e0ab_: 1e0a B:

Lineage for d1e0ab_ (1e0a B:)

1. Root: SCOP 1.65

2. Class j: Peptides [58231] (105 folds)

3. Fold j.65: Peptide derived from p-21 activated kinase [58722] (1 superfamily)

4. Superfamily j.65.1: Peptide derived from p-21 activated kinase [58723] (1 family)

5. Family j.65.1.1: Peptide derived from p-21 activated kinase [58724] (1 protein)

6. Protein Peptide derived from p-21 activated kinase [58725] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [58727] (1 PDB entry)

8. Domain d1e0ab_: 1e0a B: [46357]
   Other proteins in same PDB: d1e0aa_
   bound to CDC42Hs
   complexed with gnp, mg; mutant

Details for d1e0ab_

PDB Entry: 1e0a

PDB Description: cdc42 complexed with the gtpase binding domain of p21 activated kinase

SCOP Domain Sequences for d1e0ab_:

Sequence; same for both SEQRES and ATOM records:

>d1e0ab_ j.65.1.1 (B:) Peptide derived from p-21 activated kinase {Norway rat (Rattus norvegicus)}
gsislpsdfehtihvgfdavtgeftgmpeqwarllqtsnitkseqk

Timeline for d1e0ab_:

• d1e0ab_ first appeared (with stable ids) in SCOP 1.55
  
• d1e0ab_ appears in SCOP 1.63
  
• d1e0ab_ appears in SCOP 1.67
  
• d1e0ab_ appears in the current release, SCOPe 2.08, called d1e0ab1