Lineage for d1gp8a_ (1gp8 A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046871Fold j.58: Coat protein-binding domain of bacteriophage P22 scaffolding protein [58687] (1 superfamily)
  4. 3046872Superfamily j.58.1: Coat protein-binding domain of bacteriophage P22 scaffolding protein [58688] (1 family) (S)
  5. 3046873Family j.58.1.1: Coat protein-binding domain of bacteriophage P22 scaffolding protein [58689] (1 protein)
  6. 3046874Protein Coat protein-binding domain of bacteriophage P22 scaffolding protein [58690] (1 species)
  7. 3046875Species Salmonella bacteriophage P22 [TaxId:10754] [58691] (2 PDB entries)
  8. 3046876Domain d1gp8a_: 1gp8 A: [46342]

Details for d1gp8a_

PDB Entry: 1gp8 (more details)

PDB Description: nmr solution structure of the coat protein-binding domain of bacteriophage p22 scaffolding protein
PDB Compounds: (A:) protein (scaffolding protein)

SCOPe Domain Sequences for d1gp8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gp8a_ j.58.1.1 (A:) Coat protein-binding domain of bacteriophage P22 scaffolding protein {Salmonella bacteriophage P22 [TaxId: 10754]}
itgdvsaankdairkqmdaaaskgdvetyrklkaklkgir

SCOPe Domain Coordinates for d1gp8a_:

Click to download the PDB-style file with coordinates for d1gp8a_.
(The format of our PDB-style files is described here.)

Timeline for d1gp8a_: