Lineage for d1tbca_ (1tbc A:)
- Root: SCOPe 2.08
Class j: Peptides [58231] (151 folds) 
Fold j.40: Transactivation protein TAT [58593] (1 superfamily) Superfamily j.40.1: Transactivation protein TAT [58594] (1 family) 
Family j.40.1.1: Transactivation protein TAT [58595] (1 protein) Protein Transactivation protein TAT [58596] (2 species) 
Species Human immunodeficiency virus type 1 [TaxId:11676] [58598] (4 PDB entries) 
Domain d1tbca_: 1tbc A: [46305]
Details for d1tbca_
PDB Entry: 1tbc (more details)
PDB Description: hiv-1 tat, nmr, 10 structures
PDB Compounds: (A:) tat proteinSCOPe Domain Sequences for d1tbca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbca_ j.40.1.1 (A:) Transactivation protein TAT {Human immunodeficiency virus type 1 [TaxId: 11676]}
ldpvdpniepwnhpgsqpktacnrchckkccyhcqvcfitkglgisygrkkrrqrrrpsq
ggqthqdpipkqpssqprgdptgpke
SCOPe Domain Coordinates for d1tbca_:
Click to download the PDB-style file with coordinates for d1tbca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tbca_:
- d1tbca_ first appeared (with stable ids) in SCOP 1.55, called d1tbc__
- d1tbca_ appears in SCOPe 2.07
View in 3D