![]() | Class j: Peptides [58231] (151 folds) |
![]() | Fold j.35: Transmembrane helical fragments [58517] (1 superfamily) |
![]() | Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) ![]() |
![]() | Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins) the member of this family may be not related |
![]() | Protein Rhodopsin fragments [58522] (1 species) |
![]() | Species Synthetic, based on Bos taurus sequence [58523] (6 PDB entries) |
![]() | Domain d1edxa_: 1edx A: [46243] amino terminus (residues 1-40) |
PDB Entry: 1edx (more details)
SCOPe Domain Sequences for d1edxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edxa_ j.35.1.1 (A:) Rhodopsin fragments {Synthetic, based on Bos taurus sequence} mngtegpnfyvpfsnktgvvrspfeapqyylaepwefsml
Timeline for d1edxa_: