![]() | Class j: Peptides [58231] (151 folds) |
![]() | Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily) |
![]() | Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) ![]() |
![]() | Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein) |
![]() | Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [58383] (1 PDB entry) |
![]() | Domain d1zwca_: 1zwc A: [46167] |
PDB Entry: 1zwc (more details)
SCOPe Domain Sequences for d1zwca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zwca_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Cow (Bos taurus) [TaxId: 9913]} avseiqfmhnlgkhlssmervewlrkklqdvhnfval
Timeline for d1zwca_: