SCOPe 2.08: Domain d1zwca_: 1zwc A:

Lineage for d1zwca_ (1zwc A:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)

4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family)

5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)

6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [58383] (1 PDB entry)

8. Domain d1zwca_: 1zwc A: [46167]

Details for d1zwca_

PDB Entry: 1zwc

PDB Description: structure of bovine parathyroid hormone fragment 1-37, nmr, 10 structures

PDB Compounds: (A:) parathyroid hormone

SCOPe Domain Sequences for d1zwca_:

Sequence; same for both SEQRES and ATOM records:

>d1zwca_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Cow (Bos taurus) [TaxId: 9913]}
avseiqfmhnlgkhlssmervewlrkklqdvhnfval

Timeline for d1zwca_:

• d1zwca_ first appeared (with stable ids) in SCOP 1.55, called d1zwc__
  
• d1zwca_ appears in SCOPe 2.07