Lineage for d1bkua_ (1bku A:)

  1. Root: SCOPe 2.01
  2. 1072259Class j: Peptides [58231] (120 folds)
  3. 1072474Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1072475Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1072476Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1072477Protein Calcitonin [58301] (3 species)
  7. 1072481Species Eel (Anguilla japonica) [TaxId:7937] [58302] (3 PDB entries)
  8. 1072482Domain d1bkua_: 1bku A: [46104]

Details for d1bkua_

PDB Entry: 1bku (more details)

PDB Description: effects of glycosylation on the structure and dynamics of eel calcitonin, nmr, 10 structures
PDB Compounds: (A:) calcitonin

SCOPe Domain Sequences for d1bkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkua_ j.6.1.1 (A:) Calcitonin {Eel (Anguilla japonica) [TaxId: 7937]}
csnlstcvlgklsqelhklqtyprtdvgagtp

SCOPe Domain Coordinates for d1bkua_:

Click to download the PDB-style file with coordinates for d1bkua_.
(The format of our PDB-style files is described here.)

Timeline for d1bkua_: