Lineage for d1qbfa_ (1qbf A:)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2271640Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 2271641Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 2271642Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 2271722Protein Peptide YY, PYY [58292] (2 species)
  7. 2271726Species Pig (Sus scrofa) [TaxId:9823] [58293] (6 PDB entries)
    Uniprot P68005
  8. 2271732Domain d1qbfa_: 1qbf A: [46092]

Details for d1qbfa_

PDB Entry: 1qbf (more details)

PDB Description: nmr solution structure of porcine peptide yy
PDB Compounds: (A:) Peptide YY

SCOPe Domain Sequences for d1qbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbfa_ j.6.1.1 (A:) Peptide YY, PYY {Pig (Sus scrofa) [TaxId: 9823]}
ypakpeapgedaspeelsryyaslrhylnlvtrqry

SCOPe Domain Coordinates for d1qbfa_:

Click to download the PDB-style file with coordinates for d1qbfa_.
(The format of our PDB-style files is described here.)

Timeline for d1qbfa_: