Lineage for d1rona_ (1ron A:)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 899306Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 899307Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 899308Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 899360Protein Neuropeptide Y [58289] (2 species)
  7. 899361Species Human (Homo sapiens) [TaxId:9606] [58290] (2 PDB entries)
  8. 899362Domain d1rona_: 1ron A: [46090]

Details for d1rona_

PDB Entry: 1ron (more details)

PDB Description: nmr solution structure of human neuropeptide y
PDB Compounds: (A:) neuropeptide y

SCOP Domain Sequences for d1rona_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rona_ j.6.1.1 (A:) Neuropeptide Y {Human (Homo sapiens) [TaxId: 9606]}
ypskpdnpgedapaedmaryysalrhyinlitrqry

SCOP Domain Coordinates for d1rona_:

Click to download the PDB-style file with coordinates for d1rona_.
(The format of our PDB-style files is described here.)

Timeline for d1rona_: