PDB entry 1ron

View 1ron on RCSB PDB site
Description: nmr solution structure of human neuropeptide y
Class: neuropeptide
Keywords: neuropeptide, cleavage on pair of basic residues, signal, amidation, neuromodulator
Deposited on 1996-01-11, released 1996-08-17
The last revision prior to the SCOP 1.75 freeze date was dated 1996-08-17, with a file datestamp of 2007-06-04.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neuropeptide y
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01303 (0-35)
  Domains in SCOP 1.75: d1rona_
• Heterogens: NH2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ronA (A:)
  ypskpdnpgedapaedmaryysalrhyinlitrqry