Lineage for d1ron__ (1ron -)

  1. Root: SCOP 1.67
  2. 434008Class j: Peptides [58231] (111 folds)
  3. 434188Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 434189Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 434190Family j.6.1.1: Peptide hormones [58285] (14 proteins)
  6. 434229Protein Neuropeptide Y [58289] (2 species)
  7. 434230Species Human (Homo sapiens) [TaxId:9606] [58290] (1 PDB entry)
  8. 434231Domain d1ron__: 1ron - [46090]

Details for d1ron__

PDB Entry: 1ron (more details)

PDB Description: nmr solution structure of human neuropeptide y

SCOP Domain Sequences for d1ron__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ron__ j.6.1.1 (-) Neuropeptide Y {Human (Homo sapiens)}
ypskpdnpgedapaedmaryysalrhyinlitrqry

SCOP Domain Coordinates for d1ron__:

Click to download the PDB-style file with coordinates for d1ron__.
(The format of our PDB-style files is described here.)

Timeline for d1ron__: