PDB entry 1ron

View 1ron on RCSB PDB site
Description: nmr solution structure of human neuropeptide y
Deposited on 1996-01-11, released 1996-08-17
The last revision prior to the SCOP 1.67 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1ron__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ron_ (-)
    ypskpdnpgedapaedmaryysalrhyinlitrqry