SCOP 1.61: Domain d1ron__: 1ron -

Lineage for d1ron__ (1ron -)

1. Root: SCOP 1.61

2. Class j: Peptides [58231] (95 folds)

3. Fold j.6: Peptide hormones [58283] (1 superfamily)

4. Superfamily j.6.1: Peptide hormones [58284] (1 family)

5. Family j.6.1.1: Peptide hormones [58285] (11 proteins)

6. Protein Neuropeptide Y [58289] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58290] (1 PDB entry)

8. Domain d1ron__: 1ron - [46090]

Details for d1ron__

PDB Entry: 1ron

PDB Description: nmr solution structure of human neuropeptide y

SCOP Domain Sequences for d1ron__:

Sequence; same for both SEQRES and ATOM records:

>d1ron__ j.6.1.1 (-) Neuropeptide Y {Human (Homo sapiens)}
ypskpdnpgedapaedmaryysalrhyinlitrqry

Timeline for d1ron__:

• d1ron__ first appeared (with stable ids) in SCOP 1.55
  
• d1ron__ appears in SCOP 1.59
  
• d1ron__ appears in SCOP 1.63
  
• d1ron__ appears in the current release, SCOPe 2.08, called d1rona_